Skin Therapy by Maritza
Unclaimed

Skin Therapy by Maritza

4(20 Google reviews)
6005 Eastridge Rd suite 155, Odessa, TX 79762
Medical-Grade

About This Clinic

Skin Therapy by Maritza is a medical spa in Odessa, TX, offering aesthetic and wellness treatments. Known for quality care, they serve patients throughout the Odessa area.

Treatments & Services

acnedermaplaningfacialshydrafacialskincare

Clinic Info

CityOdessa
Price Range$$
Google Rating
4(20)
StatusUnverified

GlowScore™

⭐ Standard
49/ 100

Score reflects rating, review volume, profile completeness, and booking availability.

Rating quality12/30
Review volume10/20
Profile completeness15/20
Online booking0/15
Peptide signals0/10
Creator presence0/5

Claim your listing to improve your GlowScore™

Improve Your Score →

Pricing

Price Range$$
🏢

Is this your clinic?

430+ patients searched your area last month. Claim your listing to capture leads.

Claim This Listing →

Find Your Match

Not sure what's right for you? Take our 2-minute quiz for personalized recommendations.

Take the Free Quiz →

Request Appointment

We'll connect you with Skin Therapy by Maritza.

Free to use · No spam · We'll connect you directly