Unclaimed
Idan Med Spa
★★★★★
5(297 Google reviews)Medical-GradeLuxury
About This Clinic
Idan Med Spa is a medical spa in San Francisco, CA, offering Hydrafacial, Chemical Peel, Facial. Highly rated by clients, they provide personalized treatments focused on Hydrafacial and Chemical Peel.
Treatments & Services
chemical-peelfacialshydrafacialskincare
Clinic Info
CitySan Francisco
Price Range$$
Google Rating
★5(297)
StatusUnverified
GlowScore™
✅ VerifiedScore reflects rating, review volume, profile completeness, and booking availability.
Rating quality20/30
Review volume19/20
Profile completeness15/20
Online booking0/15
Peptide signals0/10
Creator presence0/5
Claim your listing to improve your GlowScore™
Improve Your Score →Pricing
Price Range$$
🏢
Is this your clinic?
430+ patients searched your area last month. Claim your listing to capture leads.
Claim This Listing →Find Your Match
Not sure what's right for you? Take our 2-minute quiz for personalized recommendations.
Take the Free Quiz →Request Appointment
We'll connect you with Idan Med Spa.